Claude Code SkillScientific2 installs

Gget

"CLI/Python toolkit for rapid bioinformatics queries. Preferred for quick BLAST searches. Access to 20+ databases: gene info (Ensembl/UniProt), AlphaFold, ARCHS4, Enrichr, OpenTargets, COSMIC, genome downloads. For advanced BLAST/batch processing, use biopython. For multi-database integration, use bioservices."

Install with the Claude Code Templates CLI
$ npx claude-code-templates@latest --skill="scientific/gget" --yes

Requires Claude Code. The command adds this skill to your project's .claudedirectory — nothing runs on ToolZip's servers.

What's inside this skill

Component source (preview)

gget

Overview

gget is a command-line bioinformatics tool and Python package providing unified access to 20+ genomic databases and analysis methods. Query gene information, sequence analysis, protein structures, expression data, and disease associations through a consistent interface. All gget modules work both as command-line tools and as Python functions.

Important: The databases queried by gget are continuously updated, which sometimes changes their structure. gget modules are tested automatically on a biweekly basis and updated to match new database structures when necessary.

Installation

Install gget in a clean virtual environment to avoid conflicts:

# Using uv (recommended)
uv uv pip install gget

# Or using pip
uv pip install --upgrade gget

# In Python/Jupyter
import gget

Quick Start

Basic usage pattern for all modules:

# Command-line
gget <module> [arguments] [options]

# Python
gget.module(arguments, options)

Most modules return:

  • Command-line: JSON (default) or CSV with -csv flag
  • Python: DataFrame or dictionary

Common flags across modules:

  • -o/--out: Save results to file
  • -q/--quiet: Suppress progress information
  • -csv: Return CSV format (command-line only)

Module Categories

1. Reference & Gene Information

gget ref - Reference Genome Downloads

Retrieve download links and metadata for Ensembl reference genomes.

Parameters:
  • species: Genus_species format (e.g., 'homo_sapiens', 'mus_musculus'). Shortcuts: 'human', 'mouse'
  • -w/--which: Specify return types (gtf, cdna, dna, cds, cdrna, pep). Default: all
  • -r/--release: Ensembl release number (default: latest)
  • -l/--list_species: List available vertebrate species
  • -liv/--list_iv_species: List available invertebrate species
  • -ftp: Return only FTP links
  • -d/--download: Download files (requires curl)

Examples:
# List available species
gget ref --list_species

# Get all reference files for human
gget ref homo_sapiens

# Download only GTF annotation for mouse
gget ref -w gtf -d mouse
# Python
gget.ref("homo_sapiens")
gget.ref("mus_musculus", which="gtf", download=True)

gget search - Gene Search

Locate genes by name or description across species.

Parameters:
  • searchwords: One or more search terms (case-insensitive)
  • -s/--species: Target species (e.g., 'homo_sapiens', 'mouse')
  • -r/--release: Ensembl release number
  • -t/--id_type: Return 'gene' (default) or 'transcript'
  • -ao/--andor: 'or' (default) finds ANY searchword; 'and' requires ALL
  • -l/--limit: Maximum results to return

Returns: ensembl_id, gene_name, ensembl_description, ext_ref_description, biotype, URL Examples:
# Search for GABA-related genes in human
gget search -s human gaba gamma-aminobutyric

# Find specific gene, require all terms
gget search -s mouse -ao and pax7 transcription
# Python
gget.search(["gaba", "gamma-aminobutyric"], species="homo_sapiens")

gget info - Gene/Transcript Information

Retrieve comprehensive gene and transcript metadata from Ensembl, UniProt, and NCBI.

Parameters:
  • ens_ids: One or more Ensembl IDs (also supports WormBase, Flybase IDs). Limit: ~1000 IDs
  • -n/--ncbi: Disable NCBI data retrieval
  • -u/--uniprot: Disable UniProt data retrieval
  • -pdb: Include PDB identifiers (increases runtime)

Returns: UniProt ID, NCBI gene ID, primary gene name, synonyms, protein names, descriptions, biotype, canonical transcript Examples:
# Get info for multiple genes
gget info ENSG00000034713 ENSG00000104853 ENSG00000170296

# Include PDB IDs
gget info ENSG00000034713 -pdb
# Python
gget.info(["ENSG00000034713", "ENSG00000104853"], pdb=True)

gget seq - Sequence Retrieval

Fetch nucleotide or amino acid sequences for genes and transcripts.

Parameters:
  • ens_ids: One or more Ensembl identifiers
  • -t/--translate: Fetch amino acid sequences instead of nucleotide
  • -iso/--isoforms: Return all transcript variants (gene IDs only)

Returns: FASTA format sequences Examples:
# Get nucleotide sequences
gget seq ENSG00000034713 ENSG00000104853

# Get all protein isoforms
gget seq -t -iso ENSG00000034713
# Python
gget.seq(["ENSG00000034713"], translate=True, isoforms=True)

2. Sequence Analysis & Alignment

gget blast - BLAST Searches

BLAST nucleotide or amino acid sequences against standard databases.

Parameters:
  • sequence: Sequence string or path to FASTA/.txt file
  • -p/--program: blastn, blastp, blastx, tblastn, tblastx (auto-detected)
  • -db/--database:
- Nucleotide: nt, refseq_rna, pdbnt

- Protein: nr, swissprot, pdbaa, refseq_protein

  • -l/--limit: Max hits (default: 50)
  • -e/--expect: E-value cutoff (default: 10.0)
  • -lcf/--low_comp_filt: Enable low complexity filtering
  • -mbo/--megablast_off: Disable MegaBLAST (blastn only)

Examples:
# BLAST protein sequence
gget blast MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR

# BLAST from file with specific database
gget blast sequence.fasta -db swissprot -l 10
# Python
gget.blast("MKWMFK...", database="swissprot", limit=10)

gget blat - BLAT Searches

Locate genomic positions of sequences using UCSC BLAT.

Parameters:
  • sequence: Sequence string or path to FASTA/.txt file
  • -st/--seqtype: 'DNA', 'protein', 'translated%20RNA', 'translated%20DNA' (auto-detected)
  • -a/--assembly: Target assembly (default: 'human'/hg38; options: 'mouse'/mm39, 'zebrafinch'/taeGut2, etc.)

Returns: genome, query size, alignment positions, matches, mismatches, alignment percentage Examples:
# Find genomic location in human
gget blat ATCGATCGATCGATCG

# Search in different assembly
gget blat -a mm39 ATCGATCGATCGATCG
# Python
gget.blat("ATCGATCGATCGATCG", assembly="mouse")

gget muscle - Multiple Sequence Alignment

Align multiple nucleotide or amino acid sequences using Muscle5.

Parameters:
  • fasta: Sequences or path to FASTA/.txt file
  • -s5/--super5: Use Super5 algorithm for faster processing (large datasets)

Returns: Aligned sequences in ClustalW format or aligned FASTA (.afa) Examples:
# Align sequences from file
gget muscle sequences.fasta -o aligned.afa

# Use Super5 for large dataset
gget muscle large_dataset.fasta -s5
# Python
gget.muscle("sequences.fasta", save=True)

gget diamond - Local Sequence Alignment

Perform fast local protein or translated DNA alignment using DIAMOND.

Parameters:
  • Query: Sequences (string/list) or FASTA file path
  • --reference: Reference sequences (string/list) or FASTA file path (required)
  • --sensitivity: fast, mid-sensitive, sensitive, more-sensitive, very-sensitive (default), ultra-sensitive
  • --threads: CPU threads (default: 1)
  • --diamond_db: Save database for reuse
  • --translated: Enable nucleotide-to-amino acid alignment

Returns: Identity percentage, sequence lengths, match positions, gap openings, E-values, bit scores Examples:
# Align against reference
gget diamond GGETISAWESQME -ref reference.fasta --threads 4

# Save database for reuse
gget diamond query.fasta -ref ref.fasta --diamond_db my_db.dmnd
# Python
gget.diamond("GGETISAWESQME", reference="reference.fasta", threads=4)

3. Structural & Protein Analysis

gget pdb - Protein Structures

Query RCSB Protein Data Bank for structure and metadata.

Parameters:
  • pdb_id: PDB identifier (e.g., '7S7U')
  • -r/--resource: Data type (pdb, entry, pubmed, assembly, entity types)
  • -i/--identifier: Assembly, entity, or chain ID

Returns: PDB format (structures) or JSON (metadata) Examples:
# Download PDB structure
gget pdb 7S7U -o 7S7U.pdb

# Get metadata
gget pdb 7S7U -r entry
# Python
gget.pdb("7S7U", save=True)

gget alphafold - Protein Structure Prediction

Predict 3D protein structures using simplified AlphaFold2.

Setup Required:
# Install OpenMM first
uv pip install openmm

# Then setup AlphaFold
gget setup alphafold
Parameters:
  • sequence: Amino acid sequence (string), multiple sequences (list), or FASTA file. Multiple sequences trigger multimer modeling
  • -mr/--multimer_recycles: Recycling iterations (default: 3; recommend 20 for accuracy)
  • -mfm/--multimer_for_monomer: Apply multimer model to single proteins
  • -r/--relax: AMBER relaxation for top-ranked model
  • plot: Python-only; generate interactive 3D visualization (default: True)
  • show_sidechains: Python-only; include side chains (default: True)

Returns: PDB structure file, JSON alignment error data, optional 3D visualization Examples:
# Predict single protein structure
gget alphafold MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR

# Predict multimer with higher accuracy
gget alphafold sequence1.fasta -mr 20 -r
# Python with visualization
gget.alphafold("MKWMFK...", plot=True, show_sidechains=True)

# Multimer prediction
gget.alphafold(["sequence1", "sequence2"], multimer_recycles=20)

gget elm - Eukaryotic Linear Motifs

Predict Eukaryotic Linear Motifs in protein sequences.

Setup Required:
gget setup elm
Parameters:
  • sequence: Amino acid sequence or UniProt Acc
  • -u/--uniprot: Indicates sequence is UniProt Acc
  • -e/--expand: Include protein names, organisms, references
  • -s/--sensitivity: DIAMOND alignment sensitivity (default: "very-sensitive")
  • -t/--threads: Number of threads (default: 1)

Returns: Two outputs:
  • ortholog_df: Linear motifs from orthologous proteins
  • regex_df: Motifs directly matched in input sequence

Examples:
# Predict motifs from sequence
gget elm LIAQSIGQASFV -o results

# Use UniProt accession with expanded info
gget elm --uniprot Q02410 -e
# Python
ortholog_df, regex_df = gget.elm("LIAQSIGQASFV")

4. Expression & Disease Data

gget archs4 - Gene Correlation & Tissue Expression

Query ARCHS4 database for correlated genes or tissue expression data.

Parameters:
  • gene: Gene symbol or Ensembl ID (with --ensembl flag)
  • -w/--which: 'correlation' (default, returns 100 most correlated genes) or 'tissue' (expression atlas)
  • -s/--species: 'human' (default) or 'mouse' (tissue data only)
  • -e/--ensembl: Input is Ensembl ID

Returns:
  • Correlation mode: Gene symbols, Pearson correlation coefficients
  • Tissue mode: Tissue identifiers, min/Q1/median/Q3/max expression values

Examples:
# Get correlated genes
gget archs4 ACE2

# Get tissue expression
gget archs4 -w tissue ACE2
# Python
gget.archs4("ACE2", which="tissue")

gget cellxgene - Single-Cell RNA-seq Data

Query CZ CELLxGENE Discover Census for single-cell data.

Setup Required:
gget setup cellxgene
Parameters:
  • --gene (-g): Gene names or Ensembl IDs (case-sensitive! 'PAX7' for human, 'Pax7' for mouse)
  • --tissue: Tissue type(s)
  • --cell_type: Specific cell type(s)
  • --species (-s): 'homo_sapiens' (default) or 'mus_musculus'
  • --census_version (-cv): Version ("stable", "latest", or dated)
  • --ensembl (-e): Use Ensembl IDs
  • --meta_only (-mo): Return metadata only
  • Additional filters: disease, development_stage, sex, assay, dataset_id, donor_id, ethnicity, suspension_type

Returns: AnnData object with count matrices and metadata (or metadata-only dataframes) Examples:
# Get single-cell data for specific genes and cell types
gget cellxgene --gene ACE2 ABCA1 --tissue lung --cell_type "mucus secreting cell" -o lung_data.h5ad

# Metadata only
gget cellxgene --gene PAX7 --tissue muscle --meta_only -o metadata.csv

```python

Python

adata = gget.cellxgene(gene=["ACE2", "AB

Preview truncated. View the full source on GitHub →

Type
Skill
Category
Scientific
Installs
2
Source
GitHub ↗

Related Claude Code Skills

SkillScientific

Generate Image

Generate or edit images using AI models (FLUX, Gemini). Use for general-purpose image generation including photos, illustrations, artwork, visual assets, concept art, and any image that isn't a technical diagram or schematic. For flowcharts, circuits, pathways, and technical diagrams, use the scientific-schematics skill instead.

99 installsView →
SkillScientific

Markitdown

"Convert files and office documents to Markdown. Supports PDF, DOCX, PPTX, XLSX, images (with OCR), audio (with transcription), HTML, CSV, JSON, XML, ZIP, YouTube URLs, EPubs and more."

72 installsView →
SkillScientific

Scientific Critical Thinking

"Evaluate research rigor. Assess methodology, experimental design, statistical validity, biases, confounding, evidence quality (GRADE, Cochrane ROB), for critical analysis of scientific claims."

66 installsView →
SkillScientific

Scientific Slides

"Build slide decks and presentations for research talks. Use this for making PowerPoint slides, conference presentations, seminar talks, research presentations, thesis defense slides, or any scientific talk. Provides slide structure, design templates, timing guidance, and visual validation. Works with PowerPoint and LaTeX Beamer."

52 installsView →
SkillScientific

Statistical Analysis

"Statistical analysis toolkit. Hypothesis tests (t-test, ANOVA, chi-square), regression, correlation, Bayesian stats, power analysis, assumption checks, APA reporting, for academic research."

40 installsView →
SkillScientific

Market Research Reports

"Generate comprehensive market research reports (50+ pages) in the style of top consulting firms (McKinsey, BCG, Gartner). Features professional LaTeX formatting, extensive visual generation with scientific-schematics and generate-image, deep integration with research-lookup for data gathering, and multi-framework strategic analysis including Porter's Five Forces, PESTLE, SWOT, TAM/SAM/SOM, and BCG Matrix."

39 installsView →

Catalog data and component content are sourced from the open-source davila7/claude-code-templates project (MIT license). ToolZip curates the listing and writes original descriptions; every component links back to its original source. Claude Code is a product of Anthropic. ToolZip is an independent catalog and is not affiliated with or endorsed by Anthropic.